Powered by FoodRisk.org

Allergen

P86739.1

Accession P86739.1
Species Macruronus magellanicus
Common Name Patagonian Grenadier
Description RecName: Full=Parvalbumin beta 1
IUIS Name
Gi 0308191450
Length 98
Year Adopted 2012
Sequence >P86739.1 Putative RecName: Full=Parvalbumin beta 1 [Macruronus magellanicus]
SFAGILDDADITAALAACKAEGSFKHVEFFAKIGLAGKKVFAIIDQDKSDFVEEDELKLF
LQVFSAGARALTDAETKAGDSDGDGKIGVDEFAQMIKG
Parent Accession