Powered by FoodRisk.org

Allergen

P86742.1

Accession P86742.1
Species Macruronus novaezelandiae
Common Name Blue hake
Description RecName: Full=Parvalbumin beta 3
IUIS Name
Gi 0308191475
Length 83
Year Adopted 2012
Sequence >P86742.1 Putative RecName: Full=Parvalbumin beta 3 [Macruronus novaezelandiae]
SFNYKTFFKLAAKSNDDVKKAFFVIDQDKSGFIEEDELKLFLQNFSAGARALTAGETKTF
LAAGDSDGDGMIGVDEFQALVKA
Parent Accession