Powered by FoodRisk.org

Allergen

P86745.1

Accession P86745.1
Species Merluccius australis australis
Common Name southern hake
Description RecName: Full=Parvalbumin beta 1
IUIS Name
Gi 0308191452
Length 108
Year Adopted 2012
Sequence >P86745.1 Putative RecName: Full=Parvalbumin beta 1 [Merluccius australis australis]
AFAGILADADITAALAACKAEGTFTHGVFFTKIGLKGKSAADIKKVFGIIDQDKSDFVEE
DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVDEFAAMVKG
Parent Accession