Powered by FoodRisk.org

Allergen

P86752.1

Accession P86752.1
Species Merluccius bilinearis
Common Name Silver hake
Description RecName: Full=Parvalbumin beta 2
IUIS Name
Gi 0308191465
Length 108
Year Adopted 2012
Sequence >P86752.1 Putative RecName: Full=Parvalbumin beta 2 [Merluccius bilinearis]
AFAGILADADIAAALAACKAEGSFKHGEYFAKIGLKGKSAADIKKVFGIIDQDKSDFVEE
DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVDEFAAMVKG
Parent Accession