Powered by FoodRisk.org

Allergen

P86754.1

Accession P86754.1
Species Merluccius bilinearis
Common Name Silver hake
Description RecName: Full=Parvalbumin beta 4
IUIS Name
Gi 0308191488
Length 94
Year Adopted 2012
Sequence >P86754.1 Putative RecName: Full=Parvalbumin beta 4 [Merluccius bilinearis]
AFAGVLADADIKAALAGCAAADSFNYKTFFKACGLFFAIIDQDHSGFIEEEELKLFLQTF
SAGARALSDAETKTFLAAGDVDGDGMIGVDEFAA
Parent Accession