Powered by FoodRisk.org

Allergen

P86757.1

Accession P86757.1
Species Merluccius capensis
Common Name Shallow-water cape hake
Description RecName: Full=Parvalbumin beta 2
IUIS Name
Gi 0308191466
Length 108
Year Adopted 2012
Sequence >P86757.1 Putative RecName: Full=Parvalbumin beta 2 [Merluccius capensis]
AFSGILAEADIAAALKACEAAGTFNYKAFFAKVGLTGKSADDIKKAFFVIDQDKSGFIEE
DELKLFLQVFSAGARALTDDETKAFLKAGDSDGDGAIGVEEWAALVKA
Parent Accession