Powered by FoodRisk.org

Allergen

P86765.1

Accession P86765.1
Species Merluccius merluccius
Common Name European hake
Description RecName: Full=Parvalbumin beta 2
IUIS Name
Gi 0308191469
Length 108
Year Adopted 2012
Sequence >P86765.1 Putative RecName: Full=Parvalbumin beta 2 [Merluccius merluccius]
AFAGILADADITAALAACKAEGSFKHGEFFTKIGLKGKSAADIKKVFGIIDQDKSDFVEE
DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVDEFAAMVKG
Parent Accession