Powered by FoodRisk.org

Allergen

P86768.1

Accession P86768.1
Species Merluccius paradoxus
Common Name Deep-water cape hake
Description RecName: Full=Parvalbumin beta 1
IUIS Name
Gi 0308191457
Length 108
Year Adopted 2012
Sequence >P86768.1 Putative RecName: Full=Parvalbumin beta 1 [Merluccius paradoxus]
AFAGILADADITAALAACKAEGTFKHGEFFTKIGLKGKSPADIKKVFGIIDQDKSDFVEE
DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVDEFAAMVKG
Parent Accession