Allergen

Q06811.2

Accession Q06811.2
Species Ascaris suum
Common Name Parasitic roundworm
Description unknown function
IUIS Name Asc s 1
Gi 0077416849
Length 1365
Year Adopted 2007
Sequence >Q06811.2 Allergen Asc s 1; unknown function [Ascaris suum]
TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG
CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI
FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE
LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE
EKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAK
KELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKEELK
AKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQK
DELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELK
KLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHHFTLES
SLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREI
LKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVH
TSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKK
EATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIA
DFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKI
LHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEAL
HAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMK
KDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGA
SKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKW
LSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEE
KAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHH
FTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKG
GCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKK
IYGVHTSRRRRYHAEDGTDDIDGLAQSRQRRSGFFEKLIDVFAFF
Parent Accession