Allergen

Q1ZYQ8.2

Accession Q1ZYQ8.2
Species Zea mays
Common Name Corn
Description Expansin-B10 precursor (ZmEXPB10) (Beta-expansin-10) (Pollen allergen Zea m 1c)
IUIS Name
Gi 0115502167
Length 270
Year Adopted 2009
Sequence >Q1ZYQ8.2 Putative Expansin-B10 precursor (ZmEXPB10) (Beta-expansin-10) (Pollen allergen Zea m 1c) [Zea mays]
MAVNVRTMWSSMRAQVAMVVALVFLVRGAWCGPPKVPPGKNITATYGKDWLDAKATWYGK
PTGAGPDDNGGGCGYKDVNKPPFNSMGACGNIPIFKDGLGCGSCFEIKCDKPVECSGKPV
VVHITDMNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYDSKVTFH
LEKGCGPNYLALLVKYVDGDGDIVAVDVKEKGSDTYEPLKHSWGAIWRKDSDKPLKGPLT
VRLTTEGGTKSVYDDVIPANWKANTAYTAK
Parent Accession