Powered by FoodRisk.org

Allergen

Q28133.1

Accession Q28133.1
Species Bos taurus
Common Name Bovine
Description allergen Bos d 2.0103 [imported] - bovine
Gi 0002497701
Length 172
Year Adopted 2009
Sequence >accession|Q28133.1|Putative Allergen Bos d 2 precursor (Dander major allergen BDA20) (Dermal allergen BDA20) [Bos taurus]
MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC
INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN
YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP