Powered by FoodRisk.org

Allergen

Q45W86

Accession Q45W86
Species Arachis hypogaea
Common Name Peanut
Description Oleosin 2
Gi 0122218540
Length 137
Year Adopted 2016
Sequence >accession|Q45W86|Putative Oleosin 2 [Arachis hypogaea]
MAEALYYGGRQRQDQPRSTQLVKATTAVVAGGSLLILAGLVLAATVIGLTTITPLFVIFS
PVLVPAVITVALLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARHKLMSKA
REIKDYGQQQTSGAQAS