Powered by FoodRisk.org

Allergen

Q4W1F6

Accession Q4W1F6
Species Zea mays
Common Name Maize
Description Thioredoxin
Gi
Length 122
Year Adopted 2019
Sequence >accession|Q4W1F6|Thioredoxin [Zea mays]
MASEQGVVIACHSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAKKFTQV
VFLKVDVDEVKEVTAAYEVEAMPTFHFVKNGKTVATIVGAKKDELLALIEKHAAPAPASA
SA