Powered by FoodRisk.org

COMPARE Database

Q4W1F8

Accession Q4W1F8
Species Triticum aestivum
Common Name Bread Wheat
Description Expansin EXPB11 protein
Gi
Length 274
Year Adopted 2019
Sequence >accession|Q4W1F8|Expansin EXPB11 protein [Triticum aestivum]
MASSSIAVAAALILCILVAHAHGCYAKHHAAPSATNSSWLDAKATWYGPPHGAGPDDNGG
ACGFKNVNLPPFSSMTSCGNQPLFKDGKGCGSCYQIRCLKSDHPACSGVPKTVIITDMNY
YPVSRYHFDLSGTAFGAMAKDGRNDELRHAGMINMQFKRVPCQYPGLTVTFHVEEGSNPF
YMAILVEYENGDGDVNQLDIMESRPNGGKMAPTGQWVPMKESWGSIWRMDAHHPMKAPFS
LRITNESGKTLVAEQVIPIDWKPNKTYSSLVQFH