Powered by FoodRisk.org

Allergen

Q4W1G2

Accession Q4W1G2
Species Triticum aestivum
Common Name Bread Wheat
Description Chromatin asssociated protein
Gi
Length 112
Year Adopted 2019
Sequence >accession|Q4W1G2|Chromatin asssociated protein [Triticum aestivum]
ANGDTAFKASGKNKTATGGVAKPKRAPTPFFAFLAEFRPQYMEKHPEAKGVAAVTKAAGE
KWRSMSDEEKAKYGGKKADAPASKAVNKKESTSSKKAKTGSDVEDDGEEDEE