Powered by FoodRisk.org

Allergen

Q6EBC1.1

Accession Q6EBC1.1
Species Lupinus albus
Common Name Lupine (Field)
Description Conglutin beta 2; Lup an 1
Gi 0075121065
Length 533
Year Adopted 2017
Sequence >accession|Q6EBC1.1|Conglutin beta 2; Lup an 1 [Lupinus albus]
MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEEWQPRRQRPQSRR
EEREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYSRRQRNPYHFSSQ
RFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLN
GRATITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYD
FYPSSTKDQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQDEG
VIVIVSKKQIQKLTKHAQSSSGKDKPSDSGPFNLRSNEPIYSNKYGNFYEITPDRNPQVQ
DLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYELVGIRDQQRQQDEQEEKEEEV
IRYSARLSEGDIFVIPAGYPISINASSNLRLLGFGINADENQRNFLAGSKDNVIRQLDRA
VNELTFPGSAEDIERLIKNQQQSYFANGQPQQQQQQQSEKEGRRGRRGSSLPF