Allergen

Q7M1X7

Accession Q7M1X7
Species Agrostis alba
Common Name Bent grass
Description Group I allergen Agr a I (Form 2), pollen
IUIS Name
Gi 0075139987
Length 35
Year Adopted 2007
Sequence >Q7M1X7 Putative Group I allergen Agr a I (Form 2), pollen [Agrostis alba]
IAKVPPGPNITADYGDKWLDAKSTWYGKPTGAGPK
Parent Accession