Allergen

Q7M1X9

Accession Q7M1X9
Species Agrostis alba
Common Name Bent grass
Description Group I allergen Agr a I (Form 1), pollen
IUIS Name
Gi 0075139989
Length 35
Year Adopted 2007
Sequence >Q7M1X9 Putative Group I allergen Agr a I (Form 1), pollen [Agrostis alba]
IAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPK
Parent Accession