Allergen

Q7M1Y0

Accession Q7M1Y0
Species Anthoxanthum odoratum
Common Name Sweet vernal grass
Description beta-expansin / partial
IUIS Name Ant o 1
Gi 0075139990
Length 32
Year Adopted 2007
Sequence >Q7M1Y0 Allergen Ant o 1; beta-expansin / partial [Anthoxanthum odoratum]
IAKVPPGPNITADYGDKWLDAKSTWYGKPTGA
Parent Accession