Allergen

Q7M1Y1

Accession Q7M1Y1
External DB Link NCBI Protein
Species Schedonorus arundinaceus
Common Name tall fescue
Description beta-expansin, partial
IUIS Name
Length 35
Year Adopted 2007
Sequence >Q7M1Y1 beta-expansin, partial [Schedonorus arundinaceus]
IAKVPPGPNITAEYGDKWLDAKSTFYGKPTGAGPK
Parent Accession

Related Articles

Pubmed Authors Title Journal
2475768 Esch,R.E.; Klapper,D.G. Isolation and characterization of a major cross-reactive grass group I allergenic determinant Mol. Immunol. 26 (6), 557-561 (1989)
9314345 Hiller KM; Esch RE; Klapper DG Mapping of an allergenically important determinant of grass group I allergens. J Allergy Clin Immunol. 1997 Sep;100(3):335-40
2462587 Esch RE; Klapper DG Identification and localization of allergenic determinants on grass group I antigens using monoclonal antibodies. J Immunol. 1989 Jan 1;142(1):179-84