Powered by FoodRisk.org

Allergen

Q7X8H9.1

Accession Q7X8H9.1
Species Oryza sativa Japonica Group
Common Name Japanese rice
Description 17kDa alpha-amylase/trypsin inhibitor 2; Ory s 17kD
Gi
Length 159
Year Adopted 2018
Sequence >accession|Q7X8H9.1|17kDa alpha-amylase/trypsin inhibitor 2; Ory s 17kD [Oryza sativa Japonica Group]
MALASDKFVLSAIVLAVLTVAAAAAGYGGYGDVGEYCRVGKAVSRNPVPSCRNYIARWCA
VAGGRLDSGKQPPRQLLEPCCRELAAVPMQCRCDALSVLVRGVVTEEGDRVAGMISQHAA
PGCDAATIAGMASALTDYGRCNLQHTGFFGCPMFGGGMD