Allergen

Q94JN2.1

Accession Q94JN2.1
Species Ananas comosus
Common Name Pineapple
Description profilin
IUIS Name Ana c 1
Gi 0075306610
Length 131
Year Adopted 2010
Sequence >Q94JN2.1 Allergen Ana c 1; profilin [Ananas comosus]
MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL
APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE
RLGDYLLEQGF
Parent Accession