Allergen

Q9LD79.2

Accession Q9LD79.2
External DB Link NCBI Protein
Species Juniperus virginiana
Common Name red cedar
Description thaumatin-like
IUIS Name Jun v 3
Length 110
Year Adopted 2007
Sequence >Q9LD79.2 Jun v 3; thaumatin-like [Juniperus virginiana]
AFLLAATLTISSHMQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTAS
ARFWGRTGCTFDASGKGSCQTGDCGRQLSCTVSGAVPATLAEYTQSDQDY
Parent Accession

Related Articles

Pubmed Authors Title Journal
10969020 Soman,K.V.; Midoro-Horiuti,T.; Ferreon,J.C.; Goldblum,R.M.; Brooks,E.G.; Kurosky,A.; Braun,W.; Schein,C.H. Homology modeling and characterization of IgE binding epitopes of mountain cedar allergen Jun a 3 Biophys. J. 79 (3), 1601-1609 (2000)
11422137 Midoro-Horiuti,T.; Goldblum,R.M.; Brooks,E.G. Identification of mutations in the genes for the pollen allergens of eastern red cedar (Juniperus virginiana) Clin. Exp. Allergy 31 (5), 771-778 (2001)
10657673 Midoro-Horiuti,T.; Goldblum,R.M.; Kurosky,A.; Wood,T.G.; Brooks,E.G. Variable expression of pathogenesis-related protein allergen in mountain cedar (Juniperus ashei) pollen J. Immunol. 164 (4), 2188-2192 (2000)