Allergen

Q9NJA9.1

Accession Q9NJA9.1
Species Anisakis simplex
Common Name Parasitic fish worm
Description paramyosin
IUIS Name Ani s 2
Gi 0042559536
Length 869
Year Adopted 2009
Sequence >Q9NJA9.1 Allergen Ani s 2; paramyosin [Anisakis simplex]
MSDTLYRSPSMAIRSSTADMGALTSMSVADLGSLTRLEDKIRLLQDDFESERELRNRIER
ERADLSVQLIALTDRLQDAECATDSQIESNRKREVELSKLRKLLEESQLENEDAMNVLRK
KHQDVCLDYTEQIEQLQKKNSKIDRERQRLQHEVIELTATIDQLQKDKHVAEKMAQKFEQ
QTIELSNKVEDLNKHVNDLAQQRQRLQAENSDLLAEIHDQKVQLDNLQHVKYQLAQQLEE
SRRRLEDAERERSQMQAQLHQVQLELDSVRVALDEESAARVEAEHKLSLANTEITQWKSK
FDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEK
AQNTIAILERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAELQKMKQLYEKAVEQ
KEALARENKKLQDDLHEANEALADANRKLHELDLENARLAGEIRDLQVALKESEAARRDA
EARAQRALAELQQVRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIAR
LRKKYQAEIAELEMTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYAL
AQRKISALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNKLETE
LSTAQADLDEVTKELHAADERANRALADAARAVQELHEEQEHSMKIDALRKSLEEQVKQL
QVQIQEAEAAALLGGKRVIAKLETRIRDLEVALDEETRRHKETQSALRKKDRRIKEVQMQ
IDEEHKMFVMAQDTADRMLEKLNIQKRQLGEAEAMTMQNLQRVRRYQRELEDAEGRADQA
ESSLNLIRAKHRGTVAVGKATDVYVVEED
Parent Accession