Powered by FoodRisk.org

Allergen

Q9UVU3

Accession Q9UVU3
Species Aspergillus flavus
Common Name Fungus
Description Allergen Asp fl 1
Gi 0074665726
Length 403
Year Adopted 2007
Sequence >accession|Q9UVU3|Putative Allergen Asp fl 1 [Aspergillus flavus]
MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI
HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL
DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY
NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND
IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA
ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL
YLAALENLDGPAAVTKRIEELATKDVVKDVKGSPNLLAYNGNA