Powered by FoodRisk.org

Allergen

Q9XFM4.1

Accession Q9XFM4.1
Species Fagopyrum esculentum
Common Name Buckwheat
Description 13S globulin seed storage protein 3 precursor (Legumin-like protein 3) (Allergen Fag e 1) [Contains: 13S globulin seed storage protein 3 acidic chain; 13S globulin seed storage protein 3 basic chain]
Gi 0029839419
Length 538
Year Adopted 2009
Sequence >accession|Q9XFM4.1|Putative 13S globulin seed storage protein 3 precursor (Legumin-like protein 3) (Allergen Fag e 1) [Fagopyrum esculentum]
MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRS
EAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC
PETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFS
RGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLA
GQSKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
SKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQ
NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITS
PIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV