Powered by FoodRisk.org

Allergen

QBP14757.1

Accession QBP14757.1
Species Dermatophagoides farinae
Common Name House dust mite
Description elongation factor 2
IUIS Name
Gi
Length 844
Year Adopted 2021
Sequence >QBP14757.1 elongation factor 2 [Dermatophagoides farinae]
MVNFTVDEIRVLMNKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA
AAKAGEMRFTDTRKDEQERCITIKSTAISMYFEMREQDMVFITSADQ
KESDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCV
QTETVLRQAIAERIKPVLFMNKMDLAMLTLQLEQEDLYQKFTRIVEN
VNVIISTYADENGPMGDIRVDPSKGSVGFGSGLHGWAFSLKQFAELY
SEKFKIDVDKLMNRLWGENFYNPTAKKWSKRFDEGYKRAFCMFVLDP
IFKVFDAIMNFKKEETAKLLEKLNIVLKGEDKEKDGKNLLKVVMRTW
LPAGDSLLQMIAIHLPSPITAQKYRMELLYEGPHDDEAAVAIKSCNP
EGPLMMYISKMVPTSDKGRFYAFGRVFSGIVASGQKVRIMGPNYVHG
KKEDLVEKAIQRTVLMMGRYVESIENVPCGNICGLVGVDQFLVKTGT
ISTFKDAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSD
PMVQCIIEESGEHIVAGAGELHLEICLKDLEEDHAQIPIKTSDPVVS
YRETVSEESEIMCLSKSPNKHNRLFMKACPLQDGIAEDIDKGDINPR
DDFKVRARFLADKYNWDATDARKIWAFGPEGTGPNLLVDVTKGVQYL
NEIKDSVVAGFQWATKESVLCEENMRGVRFNIHDVTLHADAIHRGGG
QIIPTARRCLYACLLTAQPRLLEPVYLVEIQCPEQAVGGIYGVLNRR
RGHVFEESQVVGTPMFTVKAYLPVNESFGFTADLRSNTGGQAFPQCV
FDHWQILPGDPLDGKSRPYQIVMDTRKRKGLKDSLPELDNYFDKL
Parent Accession