Powered by FoodRisk.org

Allergen

QCI56569.1

Accession QCI56569.1
Species Acheta domesticus
Common Name house cricket
Description tropomyosin 2
IUIS Name
Gi
Length 202
Year Adopted 2021
Sequence >QCI56569.1 tropomyosin 2 [Acheta domesticus]
MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARGLQKK
IQTIENELDQTQEQLMQVNAKLEEKDKALQTAEGEIAALNRRIQLLEED
LERSEERLATATAKLAEASQAADESERARKILENRSLADEERMDALENQ
LKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGESKIVELEEE
LRVVGN
Parent Accession