Powered by FoodRisk.org

Allergen

QCI56571.1

Accession QCI56571.1
Species Galleria mellonella
Common Name greater wax moth
Description tropomyosin 1
IUIS Name
Gi
Length 253
Year Adopted 2021
Sequence >QCI56571.1 tropomyosin 1 [Galleria mellonella]
MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQ
TIENDLDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERS
EERLATATAKLSEASQAADESERARKVLENRSLADEERMDALENQLKEARF
LAEEADKKYDEVARKLAMVEADLERAEERAESGESKIVELEEELRVVGNNL
KSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQKEV
Parent Accession