Powered by FoodRisk.org

Allergen

QCI56574.1

Accession QCI56574.1
Species Tenebrio molitor
Common Name yellow mealworm
Description tropomyosin 1
IUIS Name
Gi
Length 112
Year Adopted 2021
Sequence >QCI56574.1 tropomyosin 1 [Tenebrio molitor]
AKLIAEEADKKYEEVARKLVLMEQDLERAEERAEQSESKIVELEEELRV
VGNNLKSLEVSEEKATLKEEEYSVTLKQVDQRLQEAEARAEFAERSVQK
LQKEVDRLEDDLLA
Parent Accession