Powered by FoodRisk.org

Allergen

QCI56575.1

Accession QCI56575.1
Species Tenebrio molitor
Common Name yellow mealworm
Description tropomyosin 2
IUIS Name
Gi
Length 117
Year Adopted 2021
Sequence >QCI56575.1 tropomyosin 2 [Tenebrio molitor]
RKLAMVEADLERAEERAEAGESKIVELEEELRVVGNNLKSLEVSEEK
ANQREEEYKNQIKNLTTRLKEAEARAEFAERSVQKLQKEVDRLEEEL
VAEKERYKEIGDDLDTAFVELIL
Parent Accession