Allergen

QCI56576.1

Accession QCI56576.1
Species Zophobas atratus
Common Name Giant mealworm beetle
Description tropomyosin
IUIS Name
Gi
Length 134
Year Adopted 2021
Sequence >QCI56576.1 tropomyosin [Zophobas atratus]
EARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGESKIVELEEELRV
VGNNLKSLEVSEEKANQREEEYKNQIKNLTTRLKEAEARAEFAERSVQKL
QKEVDRLEDELVAEKERYKEIGDDLDTAFVELIL
Parent Accession