Allergen

QCY53440.1

Accession QCY53440.1
Species Ctenopharyngodon idella
Common Name grass carp
Description parvalbumin
IUIS Name Cten i 1
Gi
Length 109
Year Adopted 2022
Sequence >QCY53440.1 Allergen Cten i 1; parvalbumin [Ctenopharyngodon idella]
MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE
EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA
Parent Accession