Powered by FoodRisk.org

Allergen

QDH76468.1

Accession QDH76468.1
Species Scylla paramamosain
Common Name Green mud crab
Description myosin light chain
IUIS Name
Gi
Length 153
Year Adopted 2021
Sequence >QDH76468.1 myosin light chain [Scylla paramamosain]
MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEK
VGGKTKKKEKMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTM
LYAELEHILLSLGERLEKSELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL
Parent Accession