Powered by FoodRisk.org

Allergen

QDO73345.1

Accession QDO73345.1
Species Prunus dulcis
Common Name Almond
Description Antimicrobial seed storage protein
IUIS Name Pru du 8
Gi
Length 264
Year Adopted 2021
Sequence >QDO73345.1 Allergen Pru du 8; Antimicrobial seed storage protein [Prunus dulcis]
MATMTKAELPLLVLFLSTLLLATSVPSVRAQVTCEEGCYSISDQSKVGE
CLQMCSSHGQSCEDRCMREARWPQQQEQCLRMCRQQEQGHHLPCREQCI
RSPDREMCERACQQQQGQGGGRQCLQRCKMITRDPRERLKCVRTCTQGQ
QQGVFQGQQQQQQVEQQCRQHCQSERDPMRQQECQEYCVGQMMQQEYEQ
QCRSRCQWERPRREQQEQCQEECTEKIRQLEQCQEGCKIQGQYGPQQQE
CQRMCREQFEQGQGIRMVA
Parent Accession