Powered by FoodRisk.org

Allergen

QEQ43417

Accession QEQ43417
Species Solanum melongena
Common Name Eggplant
Description profilin
IUIS Name Sola m 1
Gi
Length 159
Year Adopted 2021
Sequence >QEQ43417 Allergen Sola m 1; profilin [Solanum melongena]
MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCS
RSGVNCYIMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMV
IQGEPGAVIRGKKGSSGITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDY
LVDQGY
Parent Accession