Powered by FoodRisk.org

Allergen

QFI57017.1

Accession QFI57017.1
Species Scylla paramamosain
Common Name Green mud crab
Description filamin C
IUIS Name
Gi
Length 847
Year Adopted 2021
Sequence >QFI57017.1 filamin C [Scylla paramamosain]
MPSGKSDVPVIEDNRDGTVSVRYSPREEGLHELHVKYNAEHVQGSPFKFHVDSIASGYVTAYGPGLVHG
ITGEPANFTISTKDAGAGSSTLRGGLSLAVEGSSKAEISCHDNKDGTVSVSYLPTAPGEYKVSVKFAEK
HIRGSPYSVKITGEGRKRNQISVGSQSEVSLPGKVTDSDIKSLNASIQAPSGLEEPCFLKKLPNGHLGI
SFTPREVGEHLVSVKRMGNHIANSPFKINVGEKEVGDASKVKISGKCLSEGQTHKENQFTIDTRDAGYG
GLSLSIEGPSKADIQCKDNEDGTLTIGYTPTEPGYYIINLKFADNHVPGSPFTVKVTGEGTNRQTERIK
RQREAVPLTEVGSQCRLTFKLPGISPFDLGATVTSPGGVTEAAEIGEVEDGLYGVNFVPKELGVHTVSV
KYQEMHIPGSPFQFTVGPLKDGGAHRVHAGGPGLERGEQGMPNEFNVWTREAGAGSLAISVEGPSKAEI
DFKDRKDGSCYVSYVVAEPGEYRVGIKFNDKHIPDSPYKVYITPSLGEARKVELAQLPEQGSMPNKAQS
LLVCKNGAKGTLDCKFVAPSGAEEDCFTDLLDGDLYSVRFVPKEMGIHYVHIKFNGIHIPGSPFRLRIG
KDEADPAAVSVSGKGLESCVSGQKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVP
GDYYIAVKYNAYHVVGSPWKVKCTGEAHAEKGTIQESSSVVVETVEKTKSGDKGHHGTIIPKFHSDANK
VTSKGLGLKKAHINRQNNFTVNASGAGNNILYVGVYGPKSPCEEVYIKHVGHNNYQVSYKVKERGNHIL
MVMWGEEHIPGSPFKLDMF
Parent Accession