Powered by FoodRisk.org

Allergen

QIJ32297.1

Accession QIJ32297.1
Species Crassostrea angulata
Common Name Portuguese oyster
Description sarcoplasmic calcium binding protein
IUIS Name
Gi
Length 179
Year Adopted 2021
Sequence >QIJ32297.1 sarcoplasmic calcium binding protein [Crassostrea angulata]
MDYLNKKWKIWYNSLDVNHDGKISIEDVEESRNKFTNLHELVGDKAKGVQVNFEDWWN
KYIFRTGAGKEISESEFVQQLTEAYKKDKVGFIKEMQACFDCIFDVIDTNKDRTIDED
EFVYAFKAFGHENEALVRKAFSLYNKENKHVPLKDIVSEWVKFVTEEDTGKKDIIMEA
FKEGF
Parent Accession MN956521