Allergen

QOL11118.1

Accession QOL11118.1
Species Humulus japonicus
Common Name Japanese hop
Description pectin methylesterase
IUIS Name
Gi
Length 321
Year Adopted 2022
Sequence >QOL11118.1 pectin methylesterase [Humulus japonicus]
SVTAAKDGTGDFRTINDALAAIPTKYEGRYVIYVKEGLYEETVTVTKKMANVTMYGDGSQ
KSIITGSKNFVDGVRTFQTATFVVLGGGFMGKAMGFGNTAGPEKHQAVAARVQADRAIFA
NCRFEGYQDTLYTQTHRQFYRSCVVAGTIDFIFGDAAVVFQNCMLVVRLPMANQKNIVTA
RGRVDKQQTTGIVIHNCRIMADKKLEPEKARVKSFLGRPWKEYSRTIIMESTIEDLIHPD
GWLPWEGEFALKTLYYAEYNNKGPGAKVTTRVNWPGYSVINKKEAEKFTVENFLQGNDWL
NIKGIPVRYTLILRANRSEVQ
Parent Accession