Powered by FoodRisk.org

Allergen

X76395

Accession X76395
Species Olea europaea var. sylvestris
Common Name Olive tree
Description major pollen allergen
IUIS Name Ole e 1
Gi
Length 145
Year Adopted 2021
Sequence >X76395 Allergen Ole e 1; major pollen allergen [Olea europaea var. sylvestris]
EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKEN
GDVTFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTE
GWVKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPN
M
Parent Accession