Powered by FoodRisk.org

Allergen

XP_004232333.1

Accession XP_004232333.1
Species Solanum lycopersicum (Lycopersicon esculentum)
Common Name Tomato
Description PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Gi 0460373045
Length 96
Year Adopted 2016
Sequence >accession|XP_004232333.1|Allergen PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum (Lycopersicon esculentum)]
MKMTKVCSFVAVMLVMILVCDQFGANEAATCSASQLSPCLGAIQGGTAPSQDCCARLKNQ
QPCICGFMKDPNLRQYVNSPNARKVAGQCGVSIPSC