Powered by FoodRisk.org

Allergen

XP_013623213.1

Accession XP_013623213.1
Species Brassica oleracea var. oleracea
Common Name Wild cabbage
Description PREDICTED: non-specific lipid-transfer protein 3-like [Brassica oleracea var. oleracea]
IUIS Name
Gi 0922434456
Length 112
Year Adopted 2016
Sequence >XP_013623213.1 Allergen Bra o 3; lipid transfer protein (LTP) type 1 [Brassica oleracea var. oleracea]
MASALSFFTCLVLTVCIVASVDAAISCGTVTSNLAPCAVYLMKGGPVPAPCCAGVSKLNS
MAKTTPDRQQACKCLKTAAKNVNPSLASSLPGKCGVSIPYPISMSTNCDTVK
Parent Accession