Allergen

XP_014705584.1

Accession XP_014705584.1
Species Equus asinus
Common Name ass
Description lysozyme
IUIS Name Equ a 6
Gi
Length 148
Year Adopted 2020H_MS
Sequence >XP_014705584.1 Allergen Equ a 6; lysozyme [Equus asinus]
MRSTLIISLLSCFFAVYEAKVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTR
AFNGKNANGSSDYGLFQLNNKWWCKDNKRSSSNACNIMCSKLLDDNIDDDISCAKRVVRD
PKGMSAWKAWVKHCKDKDLSEYLASCNL
Parent Accession