Powered by FoodRisk.org

Allergen

XP_014705584.1

Accession XP_014705584.1
Species Equus asinus
Common Name ass
Description Allergen Equ a 6.01; lysozyme C, milk isozyme
IUIS Name
Gi
Length 148
Year Adopted 2020H_MS
Sequence >XP_014705584.1 Allergen Equ a 6.01; lysozyme C, milk isozyme [Equus asinus]
MRSTLIISLLSCFFAVYEAKVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTR
AFNGKNANGSSDYGLFQLNNKWWCKDNKRSSSNACNIMCSKLLDDNIDDDISCAKRVVRD
PKGMSAWKAWVKHCKDKDLSEYLASCNL
Parent Accession