Powered by FoodRisk.org

Allergen

XP_015174445.1

Accession XP_015174445.1
Species Polistes dominula
Common Name European Paper Wasp
Description dipeptidyl peptidase
IUIS Name Pol d 3
Gi
Length 775
Year Adopted 2019
Sequence >XP_015174445.1 Allergen Pol d 3; dipeptidyl peptidase [Polistes dominula]
MISLRSFVFLNGFIFVLLTGRTVSYVLDKDNLDRVVFRTQDDSNFPKRPFQLEETYTADY
LPRNFNGTWTSDTTLIYISETVGEILQFDVVKQQSTVIIDVSIFDDYLVESYLLSPTGRF
LLIGYDLQKGFRYSTFMRYVIYDTELGQYDKIGNGMHIALVRWAPLTDDLIYILDNNIYY
KRFSKNGFNDVQRVTDDGIAGIIYNGVADWVYEEEVLHGSSAIWFSPDGKRLAYATFDDR
KVHEILYLHYGEPGSLGDQYPTEVKIKYPKAGTPNPVVSLTLVDLHDPTLNKINLEAPVD
IVGIDNVLTNVQWKDFNTIIATWSNRVQNETEIVWYNVYGETVETLHIEEPEGWVDIKNL
FFYNGSTYMRKLQQSGTKAGRFHHVTRYEKVGSTLIQKDLTPGAIEVQDIRAIDHFNGRI
YYLASGPGEPSQRNLYSVPADGSKEPTCISCNVITPEGNQCKYADVSFSPFRSYYALVCQ
GPDPTFIDIFDSNHRKIFSWEHNLMLRLRLTKRELPIVKDLYVHANGYDSKVRLLLPHNF
DESKSYPMLVNVYAGPNTAKINDAASYSYQSYMTTNRSVIYAYIDGRGSSNKGSNMLFEI
YRNLGTVEVEDQITVTRKLQEMYSWIDSKRTAIWGWSYGGFCTAMVLAKDVDSVFKCGIS
VAPVSSWIYYDSIYTERFMGLPTPEDNLKGYDGTDVSRRVEGIRGKKFMLIHGTGDDNVH
YQQSLALAKSLEESDILFEQITYTDEAHALYGVLPHLYHSMDRFWSECFSWSNTH
Parent Accession