Powered by FoodRisk.org

Allergen

XP_015646887.1

Accession XP_015646887.1
Species Oryza sativa Japonica Group
Common Name Japanese rice
Description PREDICTED: casein kinase II subunit alpha [Oryza sativa Japonica Group].
IUIS Name
Gi
Length 333
Year Adopted 2018
Sequence >XP_015646887.1 PREDICTED: casein kinase II subunit alpha [Oryza sativa Japonica Group]
MSKARVYTDVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY
PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPG
KEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI
AKVLGTDSLNSYLNKYRIELDPQLEALVGRHSRKPWSKFINADNQHLVSPEAIDFLDKLL
RYDHQDRLTAREAMAHPYFLQVRAAENSRPRAQ
Parent Accession