Powered by FoodRisk.org

Allergen

XP_016648029.1

Accession XP_016648029.1
Species Prunus mume
Common Name Japanese Apricot
Description Pru m 7 dipeptidyl peptidase IV
IUIS Name
Gi
Length 88
Year Adopted 2019
Sequence >XP_016648029.1 Pru m 7 dipeptidyl peptidase IV [Prunus mume]
MKLGFATFLLVCLLLSSSVFEVTMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHC
VPSGTYGNKDECPCYRDLKNSKGNPKCP
Parent Accession