Powered by FoodRisk.org

Allergen

XP_018814692.1

Accession XP_018814692.1
Species Juglans regia
Common Name English walnut
Description Allergen Jug r 6; sucrose-binding protein-like
IUIS Name
Gi
Length 502
Year Adopted 2020H
Sequence >XP_018814692.1 Allergen Jug r 6; sucrose-binding protein-like [Juglans regia]
MAFKPKIPIALLLLTSLLAICAGLALAMQDPELKQCKHQCRHQRQFDEQEKEHCQRSCDE
YHIEKKARERAERRRSEEGSSREEGYEEEELGGEREEENPYVFEDEDFETRVRTDEGRIQ
VLEKFTKRSKLLRGIENFRVAILEANPQTFISPAHFDAELVVFVAKGRATITTVREEKRE
NFNVEQGDIMRIPAGTPVYLINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYR
AFSWEVLEAALKTRRDQLEKLFGKQTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTH
PFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISV
VIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHP
VAVIASRNKNLQVLCFDVNAQGNIRFPLAGKNNIVNEFEKEAKELAFNFPAREVEKIFRN
QDQEFFFPGPSRQPEEGGRAFE
Parent Accession