Allergen

XP_019446786.1

Accession XP_019446786.1
Species Lupinus angustifolius
Common Name narrow-leaved blue lupine
Description lipid transfer protein
IUIS Name Lup an 3
Gi
Length 116
Year Adopted 2022
Sequence >XP_019446786.1 Allergen Lup an 3; lipid transfer protein [Lupinus angustifolius]
MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNIL
NLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK
Parent Accession