Powered by FoodRisk.org

Allergen

XP_392204.2

Accession XP_392204.2
Species Apis mellifera
Common Name honey bee
Description platelet-derived growth factor/vascular endothelial growth factor, PVF1-like
IUIS Name
Gi
Length 318
Year Adopted 2020
Sequence >XP_392204.2 platelet-derived growth factor/vascular endothelial growth factor, PVF1-like [Apis mellifera]
MPYSKCRTFLRFFAICSFSTCGLVMAQLEDTRYPDQRIVFPDRGRETANPALEGGPSGGG
IGELAKSIQLAKKISSINSRDDFLKLVKDVPKDISFFSSSSRMGETERSNAERPNQALCM
PELQTVPLLENEPSVIYYPTCTRIKRCGGCCTHSLLSCQPTATEIRNFEILVTILESSGK
LKYQGKRIVPIEEHTQCTCDCKIKETDCNKKQSYVPEECTCACNNVDEQKKCNESNIKMW
HPDLCSCFCRETQECSTGFYFDQNSCRCLQVPLSRTWFTSTKGSDYRFGQTQRPDNVPPV
IIALDSDDPRRKPKPDPE
Parent Accession