Powered by FoodRisk.org

Allergen

100

Accession 100
Species Actinidia deliciosa
Common Name Kiwi
Description Act d 9.0101 Manual Entry [Actinia deliciosa]
Gi 0000000100
Length 109
Year Adopted 2016
Sequence >accession|2|Putative Blo t 1.02 Manual Entry [Blomia tropicalis]
MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVE
EHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWR
QKARLTRIRQQGACGSCWAFAAAGVAESLYSIQKQQSIGLSEQELVDCTYNRYDPSYQCN
GCGSGYSTEAFKYMIRTGLVEERNYPYNMRTQWCDPDVEGQRYHVSGYQQLRYHSSDEDV
MYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQGVDYWIIR
NSWGTGWGNGGYGYVERGHNSLGINNYVTYATL